PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do018894.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 291aa    MW: 29742 Da    PI: 8.9379
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do018894.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.5e-3946105362
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  +a+kcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+ss
  Do018894.1  46 PEAVKCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKAKRSS 105
                 5789****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2934103IPR003851Zinc finger, Dof-type
PfamPF027012.5E-3348103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.32949103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MQEFQSIPGL AGRLFGGAAA ADLRRAQAQQ GPGARCGGVS PAAAAPEAVK CPRCESTNTK  60
FCYYNNYNLS QPRHFCKSCR RYWTKGGVLR NVPVGGGCRK AKRSSASSSS SASSAPSTPT  120
SAADARNPRR ASASSPRSNS GSGSASPTTA ATTTAPTPTT PATPSSSSIA HTSHHHRHAN  180
PFSTVDVAPP APIFADQAAA LASLFAPPPP PPLPVFTFAA QPKEDAAAAV SALHLAGHAA  240
TSSEAPASVD MTPFASLDTS GMFELGDASV AAYWSAGSCW TDVHDPSMYL P
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432570.0AC243257.1 Panicum virgatum clone PV_ABa103-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953765.11e-128PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLA0A0A9E8671e-121A0A0A9E867_ARUDO; Uncharacterized protein
STRINGSb04g029300.11e-107(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-34OBF binding protein 4